PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000153-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 221aa    MW: 25223.9 Da    PI: 9.9195
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000153-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-17956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++++++G g W++++ + g++R++k+c++rw++yl
    NNU_000153-RA  9 KGSWTEEEDILLRECIEKYGEGKWHRVPVRAGLKRCRKSCRLRWLNYL 56
                     799*******************************************97 PP

2Myb_DNA-binding42.71.3e-1362105146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T++E +l+ +++k+lG++ W++Ia +++ gRt++++k++ ++
    NNU_000153-RA  62 RGQFTADEVDLITRLHKLLGNR-WSLIAGRLP-GRTANDIKNYCNT 105
                      899*******************.*********.**********886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-23459IPR009057Homeodomain-like
PROSITE profilePS5129426.335460IPR017930Myb domain
SuperFamilySSF466898.07E-286102IPR009057Homeodomain-like
SMARTSM007171.1E-14858IPR001005SANT/Myb domain
PfamPF002495.3E-16956IPR001005SANT/Myb domain
CDDcd001671.33E-111156No hitNo description
Gene3DG3DSA:1.10.10.603.4E-2160110IPR009057Homeodomain-like
SMARTSM007171.4E-1261109IPR001005SANT/Myb domain
PROSITE profilePS5129416.0561111IPR017930Myb domain
PfamPF002496.7E-1262105IPR001005SANT/Myb domain
CDDcd001678.19E-965105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MLSNPGLRKG SWTEEEDILL RECIEKYGEG KWHRVPVRAG LKRCRKSCRL RWLNYLKPDI  60
KRGQFTADEV DLITRLHKLL GNRWSLIAGR LPGRTANDIK NYCNTRMRKN KVSPRKEKET  120
TDDKIVTQKT KVFRPRPLNF CKNSPCFLRR MADSTSVGAV SHPQTGEEMP SNNNNNNNNE  180
VFLSLDLPPP TDEALPWWKS ILAGCENEIV GDNGISCSIS G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-24410922126MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253283.11e-163PREDICTED: transcription factor MYB114-like
SwissprotQ9FNV94e-62MY113_ARATH; Transcription factor MYB113
TrEMBLC1JAC91e-69C1JAC9_TOBAC; Anthocyanin 2
TrEMBLC1JAD01e-69C1JAD0_NICTO; Anthocyanin 2
STRINGPOPTR_0005s14480.17e-65(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-63myb domain protein 113